HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJU9

Names and origin
Entry : T2BJU9 (unreviewed)
Entry name : T2BJU9_HAEIF
Protein names : Na+-dependent transporter
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : yocS
ORF names : HifGL_000686
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 60 residues
>T2BJU9|T2BJU9_HAEIF Haemophilus influenzae KR494
MTALFILFNKNSGLGAALAATHFNPIATVPSALFSFWHNVSGPILANIFSNIKNEK