HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJS8

Names and origin
Entry : T2BJS8 (unreviewed)
Entry name : T2BJS8_HAEIF
Protein names : Putative heavy metal transport/detoxification protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000662
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 100 residues
>T2BJS8|T2BJS8_HAEIF Haemophilus influenzae KR494
MKKLCTALLLSLFAISFAHANETKQIVLKVNEMNCQLCAYLVNKELRNIDGVISTKASIK
DRTVTVVEDPKVADEQLINAIHKLEYTTEVIK