HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJQ9

Names and origin
Entry : T2BJQ9 (unreviewed)
Entry name : T2BJQ9_HAEIF
Protein names : Posttranslational modification, protein turnover, chaperones
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001210
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 57 residues
>T2BJQ9|T2BJQ9_HAEIF Haemophilus influenzae KR494
MFCVFSIAIFCSPDDDVEFCIAKVGAAQQSAVINRNVFDSFIAFPYEVKINVT