HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJK5

Names and origin
Entry : T2BJK5 (unreviewed)
Entry name : T2BJK5_HAEIF
Protein names : Hydrogenase maturation factor
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001137
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 43 residues
>T2BJK5|T2BJK5_HAEIF Haemophilus influenzae KR494
MGFAMSVIDEDEAKKTQEALITMSQLEHEVGDFLGLNQK