HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJK1

Names and origin
Entry : T2BJK1 (unreviewed)
Entry name : T2BJK1_HAEIF
Protein names : RpmB protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpmB
ORF names : HifGL_000577
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 86 residues
>T2BJK1|T2BJK1_HAEIF Haemophilus influenzae KR494
MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID
KKGIDAVLAEIRARGEKI