HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJJ3

Names and origin
Entry : T2BJJ3 (unreviewed)
Entry name : T2BJJ3_HAEIF
Protein names : 30S ribosomal protein S19
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpsS
ORF names : HifGL_000456
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S19P family
Protein sequence
Length : 99 residues
>T2BJJ3|T2BJJ3_HAEIF Haemophilus influenzae KR494
MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMIGLTIAVHNGRQHVPV
YVSDEMIGHKLGEFAPTRTYRGHAADKKAKK