HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJI9

Names and origin
Entry : T2BJI9 (unreviewed)
Entry name : T2BJI9_HAEIF
Protein names : 30S ribosomal protein S10
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpsJ
ORF names : HifGL_000451
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S10P family
Protein sequence
Length : 111 residues
>T2BJI9|T2BJI9_HAEIF Haemophilus influenzae KR494
MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG