HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJG8

Names and origin
Entry : T2BJG8 (unreviewed)
Entry name : T2BJG8_HAEIF
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000626
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell membrane; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Protein sequence
Length : 94 residues
>T2BJG8|T2BJG8_HAEIF Haemophilus influenzae KR494
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK