HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJF4

Names and origin
Entry : T2BJF4 (unreviewed)
Entry name : T2BJF4_HAEIF
Protein names : DNA-binding protein fis
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : fis
ORF names : HifGL_000606
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Activator; DNA-binding; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Transcriptional regulatory fis family
Protein sequence
Length : 107 residues
>T2BJF4|T2BJF4_HAEIF Haemophilus influenzae KR494
MLEQQRNSADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLDGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG