HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJD8

Names and origin
Entry : T2BJD8 (unreviewed)
Entry name : T2BJD8_HAEIF
Protein names : Trp operon repressor homolog
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : trpR
ORF names : HifGL_000505
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to TrpR family
Subcellular location : Cytoplasm.
Protein sequence
Length : 94 residues
>T2BJD8|T2BJD8_HAEIF Haemophilus influenzae KR494
MLKTAFEQDKAQEFLTLLLTADERDAVGLRLQIVSQLLDKNLPQREIQQNLNTSAATITR
GSNMIKTMDPDFMQWMKQHLDLIEKN