HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJC2

Names and origin
Entry : T2BJC2 (unreviewed)
Entry name : T2BJC2_HAEIF
Protein names : Toxin of the YafQ-DinJ toxin-antitoxin system
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : relE
ORF names : HifGL_000369
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 110 residues
>T2BJC2|T2BJC2_HAEIF Haemophilus influenzae KR494
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGE
WKGYRDCHIQGNLVLIYQYVIQDKFDELKFSRLNTHSQTALK