HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ69

Names and origin
Entry : T2BJ69 (unreviewed)
Entry name : T2BJ69_HAEIF
Protein names : Cold shock-like protein CspD
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : cspD
ORF names : HifGL_001186
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 80 residues
>T2BJ69|T2BJ69_HAEIF Haemophilus influenzae KR494
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVIHGDKGSH
ATKIIPILDTQE