HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ62

Names and origin
Entry : T2BJ62 (unreviewed)
Entry name : T2BJ62_HAEIF
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : ftsB
ORF names : HifGL_000302
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Protein sequence
Length : 87 residues
>T2BJ62|T2BJ62_HAEIF Haemophilus influenzae KR494
MFQYDFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGLTKGFEAIEERARM
QHGLVKENEVFYHIVKESK