HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ48

Names and origin
Entry : T2BJ48 (unreviewed)
Entry name : T2BJ48_HAEIF
Protein names : Hep_Hag superfamily protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001158
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 77 residues
>T2BJ48|T2BJ48_HAEIF Haemophilus influenzae KR494
MLISSQAFAANNNSISSNYGIKEFEAYSLIIGHLKNNTINSKKAEEFTLSRIQLKNSKIS
YQMGAGWVW