HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ24

Names and origin
Entry : T2BJ24 (unreviewed)
Entry name : T2BJ24_HAEIF
Protein names : 30S ribosomal protein S13
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpsM
ORF names : HifGL_000474
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding; tRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S13P family
Protein sequence
Length : 126 residues
>T2BJ24|T2BJ24_HAEIF Haemophilus influenzae KR494
MARIAGINIPDHKHAVIALTAIYGIGKTRSQAICAAAGIAEDVKIRELSEEQIDKLRDEV
GKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKTNARTRKGPRKPIKK