HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ13

Names and origin
Entry : T2BJ13 (unreviewed)
Entry name : T2BJ13_HAEIF
Protein names : Transposase
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000247
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 122 residues
>T2BJ13|T2BJ13_HAEIF Haemophilus influenzae KR494
MGKHYTIEFKLQVIQPILNGKMSIREAVRFYNIPSNALIGTWLKRFEKSSIKGLIPRKPS
GRPPMKPKYAKMPPPPKTEEDRLRLRILQLEEEVAYLKELRRLRLQDEAEQRIK