HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BJ04

Names and origin
Entry : T2BJ04 (unreviewed)
Entry name : T2BJ04_HAEIF
Protein names : 50S ribosomal protein L23
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rplW
ORF names : HifGL_000454
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L23P family
Protein sequence
Length : 107 residues
>T2BJ04|T2BJ04_HAEIF Haemophilus influenzae KR494
MSQERLLSVLRAPHISEKATNNAEKSNTVVLKVALDANKAEIAAAVAQLFEVKVDSVRTV
VVKGKTKRRGNKMGRRSDWKKAYVTLAEGQNLDFVDSAE