HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIW8

Names and origin
Entry : T2BIW8 (unreviewed)
Entry name : T2BIW8_HAEIF
Protein names : Integration host factor subunit alpha (IHF-alpha)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : ihfA
ORF names : himA
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 104 residues
>T2BIW8|T2BIW8_HAEIF Haemophilus influenzae KR494
MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSS
RPGRNPKTGDVVPVSARRVVTFKPGQKLRARVEKTK