HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIW1

Names and origin
Entry : T2BIW1 (unreviewed)
Entry name : T2BIW1_HAEIF
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : groS
ORF names : groES
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Chaperone; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Protein sequence
Length : 104 residues
>T2BIW1|T2BIW1_HAEIF Haemophilus influenzae KR494
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDTVIFNDGYGVKSEKIDGEEVLIISENDILAIVE