HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIV2

Names and origin
Entry : T2BIV2 (unreviewed)
Entry name : T2BIV2_HAEIF
Protein names : Gluconate:H+ symporter family protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000843
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 126 residues
>T2BIV2|T2BIV2_HAEIF Haemophilus influenzae KR494
MTTVSAIGALVALIVAIFLILKKVSPAYGMLVGALVGGLIGGADLSQTVSLMIGGAQGIT
TAVMRILAAGVLAGVLIESGAANSIAETITNKLGETRALLALALAPKIIITLPKLIIV