HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIV1

Names and origin
Entry : T2BIV1 (unreviewed)
Entry name : T2BIV1_HAEIF
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : zapB
ORF names : HifGL_000296
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>T2BIV1|T2BIV1_HAEIF Haemophilus influenzae KR494
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV