HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIM4

Names and origin
Entry : T2BIM4 (unreviewed)
Entry name : T2BIM4_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000127
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 107 residues
>T2BIM4|T2BIM4_HAEIF Haemophilus influenzae KR494
MKTQVTKARLEAKVNIDIYELLKQAAAITGRTLTDFVVSVAYEEAKKTISEHQVLRLAVN
DQALLIESLSKPFEPNQSMKNALNMYEAYLSITGKNNDK