HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIE2

Names and origin
Entry : T2BIE2 (unreviewed)
Entry name : T2BIE2_HAEIF
Protein names : Transposase IS200-like protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000042
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 61 residues
>T2BIE2|T2BIE2_HAEIF Haemophilus influenzae KR494
MPDHLHLFVELHQTISVAEFVRKLKKSTHRFLDENKPLFPEFTAWSVGYCALTYSDR