HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIB3

Names and origin
Entry : T2BIB3 (unreviewed)
Entry name : T2BIB3_HAEIF
Protein names : Sec-independent protein translocase protein TatA
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : tatA
ORF names : HifGL_000870
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell membrane; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatA/E family
Subcellular location : Cell membrane; Single-pass membrane protein.
Protein sequence
Length : 83 residues
>T2BIB3|T2BIB3_HAEIF Haemophilus influenzae KR494
MFGLSPAQLIILLVVILLIFGTKKLRNAGSDLGAAVKGFKKAMKEDEKVKDAEFQSIDNE
TASAKKESIKEKEQA