HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIA8

Names and origin
Entry : T2BIA8 (unreviewed)
Entry name : T2BIA8_HAEIF
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : infA
ORF names : HifGL_000190
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>T2BIA8|T2BIA8_HAEIF Haemophilus influenzae KR494
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR