HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BIA4

Names and origin
Entry : T2BIA4 (unreviewed)
Entry name : T2BIA4_HAEIF
Protein names : Inner membrane protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : yagU
ORF names : HifGL_000185
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 79 residues
>T2BIA4|T2BIA4_HAEIF Haemophilus influenzae KR494
MALQFLLVLLQVLFTFPALGLTPPVAEWPLYEHISELVGHIFWFWTIEVIRRDLRNRITR
QPDVDEVNRNR