HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI91

Names and origin
Entry : T2BI91 (unreviewed)
Entry name : T2BI91_HAEIF
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : yacG
ORF names : HifGL_000091
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Protein sequence
Length : 76 residues
>T2BI91|T2BI91_HAEIF Haemophilus influenzae KR494
MSDEIIEVPCPICQKSVPWTNESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDPN
VSDEWSIK