HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI78

Names and origin
Entry : T2BI78 (unreviewed)
Entry name : T2BI78_HAEIF
Protein names : 50S ribosomal protein L34
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpmH
ORF names : HifGL_000624
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
Protein sequence
Length : 48 residues
>T2BI78|T2BI78_HAEIF Haemophilus influenzae KR494
MKRTFQPSVLKRSRTHGFRARMATKNGRQVLARRRAKGRKSLSA