HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI62

Names and origin
Entry : T2BI62 (unreviewed)
Entry name : T2BI62_HAEIF
Protein names : ATP synthase subunit b (ATP synthase F(0) sector subunit b) (ATPase subunit I) (F-type ATPase subunit b)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : atpF
ORF names : HifGL_000145
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell membrane; Hydrogen ion transport; Hydrolase; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase B chain family
Subcellular location : Cell membrane; Single-pass membrane protein.
Protein sequence
Length : 168 residues
>T2BI62|T2BI62_HAEIF Haemophilus influenzae KR494
MNLNATLIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNL
VEQELSAAKVQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEEL
RLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL