HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI60

Names and origin
Entry : T2BI60 (unreviewed)
Entry name : T2BI60_HAEIF
Protein names : Dithiobiotin synthetase
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000061
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 106 residues
>T2BI60|T2BI60_HAEIF Haemophilus influenzae KR494
MSKQPQILLNNTWNVRISDPGEEGAKSHFFERIYLTLTAYFEENNIRYEFVRKVEDQIKI
QRSFTELNELFKFLGDYFDPVSIGLVGVKIGNLGIKSE