HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI57

Names and origin
Entry : T2BI57 (unreviewed)
Entry name : T2BI57_HAEIF
Protein names : ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : atpC
ORF names : HifGL_000140
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell membrane; Hydrogen ion transport; Hydrolase; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase epsilon chain family
Subcellular location : Cell membrane; Peripheral membrane protein.
Protein sequence
Length : 154 residues
>T2BI57|T2BI57_HAEIF Haemophilus influenzae KR494
MATFNLTIVSAEQKIFEGEVKQIQATGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEE
VIYVSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEENIVSHGSDADHDLLVAK
LAKELAKLRAYELTEKLLKTRR