HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BI29

Names and origin
Entry : T2BI29 (unreviewed)
Entry name : T2BI29_HAEIF
Protein names : Protein-export membrane protein SecG
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : secG
ORF names : HifGL_000031
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 121 residues
>T2BI29|T2BI29_HAEIF Haemophilus influenzae KR494
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TAFFVIALVLGNMNSHKGNIQKGAFDDLSQAAEQVQQQQTAPAKENKNSDIPQ