HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHZ2

Names and origin
Entry : T2BHZ2 (unreviewed)
Entry name : T2BHZ2_HAEIF
Protein names : 50S ribosomal protein L21
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rplU
ORF names : HifGL_000080
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L21P family
Protein sequence
Length : 111 residues
>T2BHZ2|T2BHZ2_HAEIF Haemophilus influenzae KR494
MYAVFQSGGKQHRVSEGQVVRLEKLELATGETVEFDSVLMVVNGEDVKIGAPVVAGAKVV
AEVVAQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA