HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHX4

Names and origin
Entry : T2BHX4 (unreviewed)
Entry name : T2BHX4_HAEIF
Protein names : ArfA
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : arfA
ORF names : HifGL_000060
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 89 residues
>T2BHX4|T2BHX4_HAEIF Haemophilus influenzae KR494
MAKQQKSAVENETVYQHTRGVIKDNAVMALLGDKLFRQRIEKKRKGKGSYQRKVKHPGKM
FEKPDYKFFDYRNFIIGFFLG