HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHW9

Names and origin
Entry : T2BHW9 (unreviewed)
Entry name : T2BHW9_HAEIF
Protein names : YajC
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : yajC
ORF names : HifGL_000055
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 105 residues
>T2BHW9|T2BHW9_HAEIF Haemophilus influenzae KR494
MEAQSPISTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTSGGLIGKITK
VTEGSDSIVIALNDTTEITINRNYIVSVLPKGSLKSL