HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHW2

Names and origin
Entry : T2BHW2 (unreviewed)
Entry name : T2BHW2_HAEIF
Protein names : Fumarate reductase subunit D
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : frdD
ORF names : HifGL_000507
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell membrane; Membrane; Oxidoreductase; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdD family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Protein sequence
Length : 122 residues
>T2BHW2|T2BHW2_HAEIF Haemophilus influenzae KR494
MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLVDAHNLITFAYSWIGK
LVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL