HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHR6

Names and origin
Entry : T2BHR6 (unreviewed)
Entry name : T2BHR6_HAEIF
Protein names : 50S ribosomal protein L22
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rplV
ORF names : HifGL_000457
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L22P family
Protein sequence
Length : 118 residues
>T2BHR6|T2BHR6_HAEIF Haemophilus influenzae KR494
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR