HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHP0

Names and origin
Entry : T2BHP0 (unreviewed)
Entry name : T2BHP0_HAEIF
Protein names : Virulence-associated protein D
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : vapD
ORF names : HifGL_000432
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 100 residues
>T2BHP0|T2BHP0_HAEIF Haemophilus influenzae KR494
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMN
ELKQLAWISQSVRDIRAFRIEQWSDFTDFIRS