HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHM5

Names and origin
Entry : T2BHM5 (unreviewed)
Entry name : T2BHM5_HAEIF
Protein names : 50S ribosomal protein L31
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpmE
ORF names : HifGL_000417
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Metal-binding; RNA-binding; Ribonucleoprotein; Ribosomal protein; Zinc; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L31P family, Type A subfamily
Protein sequence
Length : 78 residues
>T2BHM5|T2BHM5_HAEIF Haemophilus influenzae KR494
MKQGIHPEYKEIAATCSCGNVIKTRSTLGKDINLDVCGNCHPFYTGKQRVVDTGGRVERF
NSRFKIPSTK