HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHK3

Names and origin
Entry : T2BHK3 (unreviewed)
Entry name : T2BHK3_HAEIF
Protein names : Glycerophosphodiester phosphodiesterase
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000392
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 49 residues
>T2BHK3|T2BHK3_HAEIF Haemophilus influenzae KR494
MRKDALPAFFTDVNKMYDALLNKSGVTGVFTDFPDTCVEFLKGIK