HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHI5

Names and origin
Entry : T2BHI5 (unreviewed)
Entry name : T2BHI5_HAEIF
Protein names : Putative antitoxin RelB
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : relB1
ORF names : HifGL_000370
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 106 residues
>T2BHI5|T2BHI5_HAEIF Haemophilus influenzae KR494
MALTNSSISFRTVEQTKSEAYQVIEQYGLTPSQVFNMFLAQIAKTRSIPIDLNYLRPNKE
TLAAIDELDSGNAESFFIEASENYSAEEFTKRILNGGQ