HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHA8

Names and origin
Entry : T2BHA8 (unreviewed)
Entry name : T2BHA8_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000283
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 41 residues
>T2BHA8|T2BHA8_HAEIF Haemophilus influenzae KR494
MENKYSDFNIFTSREQREGFMERISSISLALKSEKPQ