HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BHA4

Names and origin
Entry : T2BHA4 (unreviewed)
Entry name : T2BHA4_HAEIF
Protein names : Aspartate-semialdehyde dehydrogenase
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000278
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 78 residues
>T2BHA4|T2BHA4_HAEIF Haemophilus influenzae KR494
MIKTFIFLTALIALSGCGSVVKLIDPTEKYTAYAGAAYDLEMAQQWGLPILDLPLSFLLD
TVLLPYAWAQ