HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BH95

Names and origin
Entry : T2BH95 (unreviewed)
Entry name : T2BH95_HAEIF
Protein names : Aspartate-semialdehyde dehydrogenase
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000268
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 111 residues
>T2BH95|T2BH95_HAEIF Haemophilus influenzae KR494
MKKQSLPTKFSPFAWGLAAFCSPILLCPMALLISTAFSKNPHLTNWQINLFSILFWVYPF
ILAITARILYLIHQHKPKLANKLLILSAVIFYVVLITICKIGL