HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BH82

Names and origin
Entry : T2BH82 (unreviewed)
Entry name : T2BH82_HAEIF
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : csrA
ORF names : HifGL_000488
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Protein sequence
Length : 71 residues
>T2BH82|T2BH82_HAEIF Haemophilus influenzae KR494
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS