HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BH65

Names and origin
Entry : T2BH65 (unreviewed)
Entry name : T2BH65_HAEIF
Protein names : 50S ribosomal protein L36
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rpmJ
ORF names : HifGL_000473
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
Protein sequence
Length : 41 residues
>T2BH65|T2BH65_HAEIF Haemophilus influenzae KR494
MKVRASVKKMCRNCKIVKREGVVRVLCSDPKHKQRQG