HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BH61

Names and origin
Entry : T2BH61 (unreviewed)
Entry name : T2BH61_HAEIF
Protein names : 50S ribosomal protein L18
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rplR
ORF names : HifGL_000468
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L18P family
Protein sequence
Length : 125 residues
>T2BH61|T2BH61_HAEIF Haemophilus influenzae KR494
MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAAVGKAVAERALAKGVQVVAFDRSGFKYHGRVQTLADAAREAGLQF