HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BH16

Names and origin
Entry : T2BH16 (unreviewed)
Entry name : T2BH16_HAEIF
Protein names : Primosomal replication protein N
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : priB
ORF names : HifGL_000188
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 80 residues
>T2BH16|T2BH16_HAEIF Haemophilus influenzae KR494
MLEHRSEQIEGGFTRQAWLKMPVQISGNQLIEKTQSITVGGKILVVGFITSHKTQSGLCQ
LVLHAEQIEFID