HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BGJ6

Names and origin
Entry : T2BGJ6 (unreviewed)
Entry name : T2BGJ6_HAEIF
Protein names : Sulfur relay protein TusB/DsrH
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_000219
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 103 residues
>T2BGJ6|T2BGJ6_HAEIF Haemophilus influenzae KR494
MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQDGVLLAVKYPDYFVKCKGNCMILKQDIL
ARNLTALLPQSSKIKLISIEELVGITENYSPQLSL