HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BGJ1

Names and origin
Entry : T2BGJ1 (unreviewed)
Entry name : T2BGJ1_HAEIF
Protein names : SlyX
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : slyX
ORF names : HifGL_000214
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 81 residues
>T2BGJ1|T2BGJ1_HAEIF Haemophilus influenzae KR494
MQIQQMLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQPSN
IASQSEETPPPHY